PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do009641.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family TALE
Protein Properties Length: 652aa    MW: 67953.3 Da    PI: 6.6838
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do009641.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.91.9e-093613981954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Do009641.1 361 FEHflHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 398
                 664459******************************88 PP

2BELL115.82.2e-37222293172
        BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 erqe+q+kk+kL+++l+eV++rY+qy+ q+q+v ssFea+ag gsa+ Yt+lAl++iSr+FrcL+daia q+
  Do009641.1 222 ERQEMQMKKSKLINMLDEVEQRYRQYHGQMQAVSSSFEAAAGAGSARTYTALALRTISRQFRCLRDAIAAQV 293
                 79*******************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.4E-58147291IPR006563POX domain
PfamPF075263.4E-49152290IPR006563POX domain
PROSITE profilePS5007111.969339402IPR001356Homeobox domain
SMARTSM003891.2E-9342406IPR001356Homeobox domain
CDDcd000863.49E-13342403No hitNo description
SuperFamilySSF466893.85E-17344408IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-29345408IPR009057Homeodomain-like
PfamPF059202.5E-18359398IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MAAYYHGGAD TDIQASTDGL QTLYLMNPSY AGYADAGTSP PGAANMMLLN SAVSTMTPAS  60
FGHHQQSPSA AQQHFVGIPL QAPPSGYNLW TPAATSGGAD MSPQAQTPGA AGVSAVLSLS  120
SREAPPVTVA AVGGADEGKY HLGASATSQG QMVMSSKYLK AAQELLDEVV SVSKGVEDAK  180
AATKSLAAVK KKEDSEGVSG GGTEDGGAAK SGGAAPELST AERQEMQMKK SKLINMLDEV  240
EQRYRQYHGQ MQAVSSSFEA AAGAGSARTY TALALRTISR QFRCLRDAIA AQVRAASRAL  300
GEDADAAVAG GRTVGSRLRY IDHQLRQQRA LQQLGMMQGG AWRPQRGLPE RSVSILRAWL  360
FEHFLHPYPK DSDKIMLAKQ TGLTRSQVSN WFINARVRLW KPMVEEMYLE ETKDKDGGAG  420
NDEGKSGGGT KSGDTNNGVV TPRADGGSGA MSKAEGASSA KGVGGVHGST LLELAGDQHT  480
AHAGFYQDEG DDDDDVERRL KKARGEEPAA GAFHGHHVHD MAALHAQAAA AARQQHEVSH  540
RELLMKFMES GGGGAGARDH HHHQDGGGYS LFAPAPYGQF GSEPFAFAGN GGVSLTLGLP  600
HGAGGSAEQT ASFLMGSSTA GDSGSHGGAG GYDMNMQSTK SFAAQLMRDF VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5bng_A2e-17348406159Homeobox protein Meis2
5bng_B2e-17348406159Homeobox protein Meis2
4xrm_B2e-17348406563Homeobox protein Meis2
4xrm_A2e-17348406563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0860920.0BT086092.2 Zea mays full-length cDNA clone ZM_BFc0115J14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978738.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_004978740.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_004978743.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_004978744.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_012703953.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLK3ZHN10.0K3ZHN1_SETIT; Uncharacterized protein
STRINGSi026083m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48163758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.32e-74BEL1-like homeodomain 1